PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_129382g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 436aa    MW: 48634.7 Da    PI: 5.2779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_129382g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+llv++++++G g W+t +++ g+ R++k+c++rw +yl
   MA_129382g0010 14 RGPWTPEEDDLLVKYIQKHGEGGWRTLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding48.71.8e-1572112648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +m+ gRt++++k++w+++l
   MA_129382g0010  72 PDEEDLILRLHRLLGNR-WSLIAGRMP-GRTDNEIKNYWNTHL 112
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-23563IPR009057Homeodomain-like
PROSITE profilePS5129417.858961IPR017930Myb domain
SuperFamilySSF466892.9E-3011108IPR009057Homeodomain-like
SMARTSM007171.8E-141363IPR001005SANT/Myb domain
PfamPF002497.9E-171461IPR001005SANT/Myb domain
CDDcd001677.04E-121661No hitNo description
PROSITE profilePS5129425.18762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2464117IPR009057Homeodomain-like
SMARTSM007174.9E-1466114IPR001005SANT/Myb domain
PfamPF002495.5E-1472112IPR001005SANT/Myb domain
CDDcd001677.77E-1272112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MGRTPCCSKM GLNRGPWTPE EDDLLVKYIQ KHGEGGWRTL PKKAGLLRCG KSCRLRWMNY  60
LRPDVKRGQI LPDEEDLILR LHRLLGNRWS LIAGRMPGRT DNEIKNYWNT HLSKKLISEG  120
IDPRTHKPLA ESELEQLRND KSQGVDNVNS EDTNDPTSDT QQIQLEETET AMSDNIEACK  180
VIDNICHSPE LSKNVNDHPD TSAIDSLHTA ATSSSTAKAT QSTYIGSEGT YSSAVSDLGK  240
GGKLPQQSIN GAVHINQPLQ LPYCYATQEL SLEGHDWSPY LRTNTLTSSF FMAPSSGLDS  300
AQHFSDQGYQ TTARNALRGG HQYESFSTNP MQHRAVTEEI HQESYKENDG ANSCTLQANI  360
NPLGATTEDC NSDIFSYFLE SFMTEDQLLD EANYKHATPA SASVSQHMQQ LSQAQAPNHE  420
YDMWSVMSPT SQYPSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-26121162105C-Myb DNA-Binding Domain
1msf_C3e-26121162105C-Myb DNA-Binding Domain
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1110930.0BT111093.1 Picea glauca clone GQ03232_J02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297634.18e-82hypothetical protein POPTR_0001s04240g
STRINGPOPTR_0001s04240.13e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-76myb domain protein 5